PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G15530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 338aa    MW: 35889.6 Da    PI: 7.9397
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G15530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l++++++ G g+W+t +r  g++R++k+c++rw +yl
  LPERR08G15530.1 14 KGPWTPEEDEKLLQYIQKNGHGSWRTLPRLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding476e-1567142148
                      TSSS-HHHHHHHHHHHHHTTTT.............................-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.............................tWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++ +++++  lG++                             +W++Ia +++ gRt++++k++w+++l
  LPERR08G15530.1  67 RGKFSQDEEQTILHLHSILGNKydpvhrsmhrirssirheteldrnglfprRWSAIATHLP-GRTDNEIKNFWNTHL 142
                      89***********************************************************.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.105965IPR017930Myb domain
SMARTSM007173.4E-151363IPR001005SANT/Myb domain
PfamPF002495.0E-171461IPR001005SANT/Myb domain
SuperFamilySSF466892.58E-241465IPR009057Homeodomain-like
CDDcd001675.34E-121661No hitNo description
SuperFamilySSF466895.98E-65197IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-2365147IPR009057Homeodomain-like
SMARTSM007174.0E-1366144IPR001005SANT/Myb domain
PROSITE profilePS5129411.02866146IPR017930Myb domain
PfamPF002491.1E-1267142IPR001005SANT/Myb domain
CDDcd001672.08E-869142No hitNo description
SuperFamilySSF466892.58E-24115143IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDEKLLQYIQ KNGHGSWRTL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQDEEQTILH LHSILGNKYD PVHRSMHRIR SSIRHETELD RNGLFPRRWS  120
AIATHLPGRT DNEIKNFWNT HLKKRLIQMG FDPMTHRPRT DFFAALPQLI ALATLRDQLA  180
AAAAGGGGGV VDPSVAAQLQ GGGAGGGADV AIQAAKMQYL QCLLQSAATT IATAGSGVGG  240
GGGMLAPAMM ITSGGDVEAN LRLIGCGAGA GDAYACHGHG GALPPLADLS DVTTANPVAD  300
WCSATASSSC GGGGGGASSP FPWPEFCFPD DPFITDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25121465108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043761e-126AP004376.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0481F05.
GenBankAP0149641e-126AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649321.11e-133PREDICTED: myb-related protein Zm38
SwissprotQ8GWP01e-66MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D9X9450.0A0A0D9X945_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g37970.11e-144(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-87myb domain protein 93